CIRBP anticorps (N-Term)

N° du produit ABIN633585

Cet anticorps anti-CIRBP est un anticorps Lapin Polyclonal détectant CIRBP dans WB. Adapté pour Humain.

Aperçu rapide pour CIRBP anticorps (N-Term) (ABIN633585)

Antigène: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CIRBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CIRBP anticorps

Épitope: N-Term

Specificité: CIRBP antibody was raised against the N terminal of CIRBP

Purification: Affinity purified

Immunogène: CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CIRBP Blocking Peptide, (ABIN5612892), is also available for use as a blocking control in assays to test for specificity of this CIRBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIRBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CIRBP

Antigène: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Autre désignation: CIRBP

Sujet: CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization