EWSR1 anticorps (N-Term)

N° du produit ABIN633586

Cet anticorps Lapin Polyclonal détecte spécifiquement EWSR1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour EWSR1 anticorps (N-Term) (ABIN633586)

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EWSR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EWSR1 anticorps

Épitope: N-Term

Specificité: EWSR1 antibody was raised against the N terminal of EWSR1

Purification: Affinity purified

Immunogène: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EWSR1 Blocking Peptide, (ABIN5613422), is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EWSR1

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Autre désignation: EWSR1

Sujet: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Poids moléculaire: 52 kDa (MW of target protein)