EWSR1 anticorps (N-Term)
-
- Antigène Voir toutes EWSR1 Anticorps
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EWSR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- EWSR1 antibody was raised against the N terminal of EWSR1
- Purification
- Affinity purified
- Immunogène
- EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ
- Top Product
- Discover our top product EWSR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))
- Autre désignation
- EWSR1 (EWSR1 Produits)
- Synonymes
- anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b
- Sujet
- EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.
- Poids moléculaire
- 52 kDa (MW of target protein)
-