EWSR1 anticorps (N-Term)

N° du produit ABIN633586

Détail du produit anti-EWSR1 anticorps

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EWSR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EWSR1 antibody was raised against the N terminal of EWSR1

Purification: Affinity purified

Immunogène: EWSR1 antibody was raised using the N terminal of EWSR1 corresponding to a region with amino acids PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EWSR1 Blocking Peptide, catalog no. 33R-7315, is also available for use as a blocking control in assays to test for specificity of this EWSR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EWSR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EWSR1

Antigène: EWSR1 (Ewing Sarcoma Breakpoint Region 1 (EWSR1))

Autre désignation: EWSR1 (EWSR1 Produits)

Synonymes: anticorps EWS, anticorps bK984G1.4, anticorps AU018891, anticorps Ews, anticorps Ewsh, anticorps EWSR1, anticorps fc04c01, anticorps wu:fc04c01, anticorps DKFZp459K1116, anticorps ewsr1, anticorps ewsr1.S, anticorps fb40b11, anticorps fusl, anticorps wu:fb40b11, anticorps wu:fb75g09, anticorps zgc:55864, anticorps EWS RNA binding protein 1, anticorps Ewing sarcoma breakpoint region 1, anticorps EWS RNA-binding protein 1, anticorps EWS RNA-binding protein 1a, anticorps EWS RNA binding protein 1 L homeolog, anticorps EWS RNA-binding protein 1b, anticorps EWSR1, anticorps Ewsr1, anticorps ewsr1a, anticorps ewsr1, anticorps ewsr1.L, anticorps ewsr1b

Sujet: EWSR1 is a putative RNA binding protein. Mutations in this gene, specifically a t(11,22)(q24,q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors.

Poids moléculaire: 52 kDa (MW of target protein)