BAT1 anticorps (C-Term)

N° du produit ABIN633592

Cet anticorps Lapin Polyclonal détecte spécifiquement BAT1 dans WB. Il présente une réactivité envers Humain, Rat, Chien et Souris.

Aperçu rapide pour BAT1 anticorps (C-Term) (ABIN633592)

Antigène: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Reactivité: Humain, Rat, Chien, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BAT1 anticorps

Épitope: C-Term

Specificité: BAT1 antibody was raised against the C terminal of BAT1

Purification: Affinity purified

Immunogène: BAT1 antibody was raised using the C terminal of BAT1 corresponding to a region with amino acids YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BAT1 Blocking Peptide, (ABIN936032), is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAT1

Antigène: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Autre désignation: BAT1

Sujet: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly. A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization