RBM12 anticorps (Middle Region)
-
- Antigène Voir toutes RBM12 Anticorps
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RBM12 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RBM12 antibody was raised against the middle region of RBM12
- Purification
- Affinity purified
- Immunogène
- RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR
- Top Product
- Discover our top product RBM12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RBM12 Blocking Peptide, catalog no. 33R-9691, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
- Autre désignation
- RBM12 (RBM12 Produits)
- Synonymes
- anticorps HRIHFB2091, anticorps SWAN, anticorps 5730420G12Rik, anticorps 9430070C08Rik, anticorps AI852903, anticorps mKIAA0765, anticorps zgc:193560, anticorps zgc:193570, anticorps MGC68861, anticorps hrihfb2091, anticorps DKFZp469A078, anticorps RNA binding motif protein 12, anticorps RNA binding motif protein 12 L homeolog, anticorps RBM12, anticorps Rbm12, anticorps rbm12.L, anticorps rbm12, anticorps LOC733876
- Sujet
- RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.
- Poids moléculaire
- 97 kDa (MW of target protein)
-