RBM12 anticorps (N-Term)

N° du produit ABIN633604

Cet anticorps Lapin Polyclonal détecte spécifiquement RBM12 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour RBM12 anticorps (N-Term) (ABIN633604)

Antigène: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RBM12 anticorps

Épitope: N-Term

Specificité: RBM12 antibody was raised against the N terminal of RBM12

Purification: Affinity purified

Immunogène: RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM12 Blocking Peptide, (ABIN5615779), is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM12

Antigène: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Autre désignation: RBM12

Sujet: RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

Poids moléculaire: 97 kDa (MW of target protein)