SMNDC1 anticorps (Middle Region)
-
- Antigène Voir toutes SMNDC1 Anticorps
- SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMNDC1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SMNDC1 antibody was raised against the middle region of SMNDC1
- Purification
- Affinity purified
- Immunogène
- SMNDC1 antibody was raised using the middle region of SMNDC1 corresponding to a region with amino acids QFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSK
- Top Product
- Discover our top product SMNDC1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMNDC1 Blocking Peptide, catalog no. 33R-7549, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMNDC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))
- Autre désignation
- SMNDC1 (SMNDC1 Produits)
- Synonymes
- anticorps smnr, anticorps spf30, anticorps SMNDC1, anticorps SMNR, anticorps SPF30, anticorps TDRD16C, anticorps wu:fb37h07, anticorps wu:fc23a07, anticorps 2410004J23Rik, anticorps 4933440I19Rik, anticorps survival motor neuron domain containing 1, anticorps smndc1, anticorps SMNDC1, anticorps Bm1_41545, anticorps Smndc1
- Sujet
- This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.
- Poids moléculaire
- 27 kDa (MW of target protein)
-