SMNDC1 anticorps (C-Term)

N° du produit ABIN633607

Cet anticorps Lapin Polyclonal détecte spécifiquement SMNDC1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SMNDC1 anticorps (C-Term) (ABIN633607)

Antigène: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMNDC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SMNDC1 anticorps

Épitope: C-Term

Specificité: SMNDC1 antibody was raised against the C terminal of SMNDC1

Purification: Affinity purified

Immunogène: SMNDC1 antibody was raised using the C terminal of SMNDC1 corresponding to a region with amino acids KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMNDC1 Blocking Peptide, (ABIN939789), is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMNDC1

Antigène: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Autre désignation: SMNDC1

Sujet: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.

Poids moléculaire: 27 kDa (MW of target protein)