TIA1 anticorps (N-Term)

N° du produit ABIN633608

L’anticorps Lapin Polyclonal anti-TIA1 a été validé pour WB. Il convient pour détecter TIA1 dans des échantillons de Humain et Souris.

Aperçu rapide pour TIA1 anticorps (N-Term) (ABIN633608)

Antigène: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TIA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TIA1 anticorps

Épitope: N-Term

Specificité: TIA1 antibody was raised against the N terminal of TIA1

Purification: Affinity purified

Immunogène: TIA1 antibody was raised using the N terminal of TIA1 corresponding to a region with amino acids MGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TIA1 Blocking Peptide, (ABIN5616598), is also available for use as a blocking control in assays to test for specificity of this TIA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TIA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TIA1

Antigène: TIA1 (TIA1 Cytotoxic Granule-Associated RNA Binding Protein (TIA1))

Autre désignation: TIA1

Sujet: TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the induction of apoptosis as it preferentially recognises poly(A) homopolymers and induces DNA fragmentation in CTL targets. The major granule-associated species is a 15 kDa protein that is thought to be derived from the carboxyl terminus of the 40 kDa product by proteolytic processing.

Poids moléculaire: 43 kDa (MW of target protein)