TOMM40L anticorps

N° du produit ABIN633628

Cet anticorps Lapin Polyclonal détecte spécifiquement TOMM40L dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour TOMM40L anticorps (ABIN633628)

Antigène: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOMM40L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TOMM40L anticorps

Purification: Affinity purified

Immunogène: TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOMM40L Blocking Peptide, (ABIN5616729), is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOMM40L

Antigène: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Autre désignation: TOMM40L

Sujet: TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Poids moléculaire: 34 kDa (MW of target protein)