TOMM40L anticorps

N° du produit ABIN633628

Détail du produit anti-TOMM40L anticorps

Antigène: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOMM40L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOMM40L

Antigène: TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))

Autre désignation: TOMM40L (TOMM40L Produits)

Synonymes: anticorps RP11-297K8.10, anticorps TOMM40B, anticorps Tom40B, anticorps RGD1562006, anticorps Tomm40b, anticorps zgc:85715, anticorps translocase of outer mitochondrial membrane 40 like, anticorps translocase of outer mitochondrial membrane 40 homolog-like (yeast), anticorps translocase of outer mitochondrial membrane 40 homolog, like, anticorps TOMM40L, anticorps Tomm40l, anticorps tomm40l

Sujet: TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.

Poids moléculaire: 34 kDa (MW of target protein)