ASIC1 anticorps (N-Term)

N° du produit ABIN633632

L’anticorps Lapin Polyclonal anti-ASIC1 a été validé pour WB. Il convient pour détecter ASIC1 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ASIC1 anticorps (N-Term) (ABIN633632)

Antigène: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASIC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ASIC1 anticorps

Épitope: N-Term

Specificité: ACCN2 antibody was raised against the N terminal of ACCN2

Purification: Affinity purified

Immunogène: ACCN2 antibody was raised using the N terminal of ACCN2 corresponding to a region with amino acids MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACCN2 Blocking Peptide, (ABIN5611891), is also available for use as a blocking control in assays to test for specificity of this ACCN2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASIC1

Antigène: ASIC1 (ACCN2) (Amiloride-Sensitive Cation Channel 2, Neuronal (ACCN2))

Autre désignation: ACCN2

Sujet: ACCN2 is the cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. ACCN2 is also permeable for Ca2+, Li+ and K+. ACCN2 generates a biphasic current with a fast inactivating and a slow sustained phase. ACCN2 mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties.

Poids moléculaire: 65 kDa (MW of target protein)