BTBD10 anticorps

N° du produit ABIN633657

Cet anticorps anti-BTBD10 est un anticorps Polyclonal produit chez le Lapin, détectant BTBD10 dans WB. Convient pour Humain.

Aperçu rapide pour BTBD10 anticorps (ABIN633657)

Antigène: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTBD10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BTBD10 anticorps

Purification: Affinity purified

Immunogène: BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTBD10 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this BTBD10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTBD10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTBD10

Antigène: BTBD10 (BTB (POZ) Domain Containing 10 (BTBD10))

Autre désignation: BTBD10

Sujet: BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

Poids moléculaire: 54 kDa (MW of target protein)