KCTD13 anticorps (N-Term)

N° du produit ABIN633662

L’anticorps anti-KCTD13 Polyclonal produit chez le Lapin a été validé pour WB et IHC. Il convient pour la détection de KCTD13 dans des échantillons provenant de Humain et Chien. }

Aperçu rapide pour KCTD13 anticorps (N-Term) (ABIN633662)

Antigène: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD13 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-KCTD13 anticorps

Épitope: N-Term

Specificité: KCTD13 antibody was raised against the N terminal of KCTD13

Purification: Affinity purified

Immunogène: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD13 Blocking Peptide, (ABIN5614303), is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD13

Antigène: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Autre désignation: KCTD13

Sujet: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Poids moléculaire: 36 kDa (MW of target protein)