KCTD13 anticorps (N-Term)

N° du produit ABIN633662

Détail du produit anti-KCTD13 anticorps

Antigène: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCTD13 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: KCTD13 antibody was raised against the N terminal of KCTD13

Purification: Affinity purified

Immunogène: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCTD13 Blocking Peptide, catalog no. 33R-7119, is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCTD13

Antigène: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Autre désignation: KCTD13 (KCTD13 Produits)

Synonymes: anticorps KCTD13, anticorps zgc:153421, anticorps 1500003N18Rik, anticorps AV259508, anticorps PDIP1alpha, anticorps Pdip1, anticorps Poldip1, anticorps PDIP1, anticorps POLDIP1, anticorps hBACURD1, anticorps potassium channel tetramerization domain containing 13, anticorps potassium channel tetramerisation domain containing 13, anticorps KCTD13, anticorps kctd13, anticorps Kctd13

Sujet: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Poids moléculaire: 36 kDa (MW of target protein)