ACCN4 anticorps (N-Term)
-
- Antigène Voir toutes ACCN4 Anticorps
- ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ACCN4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ACCN4 antibody was raised against the N terminal of ACCN4
- Purification
- Affinity purified
- Immunogène
- ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA
- Top Product
- Discover our top product ACCN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ACCN4 Blocking Peptide, catalog no. 33R-8696, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))
- Autre désignation
- ACCN4 (ACCN4 Produits)
- Synonymes
- anticorps ACCN4, anticorps BNAC4, anticorps Accn4, anticorps Spasic, anticorps acid sensing ion channel subunit family member 4 S homeolog, anticorps acid sensing ion channel subunit family member 4, anticorps acid-sensing (proton-gated) ion channel family member 4, anticorps asic4.S, anticorps ASIC4, anticorps Asic4
- Sujet
- ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.
- Poids moléculaire
- 46 kDa (MW of target protein)
-