GABRB2 anticorps

N° du produit ABIN633763

Cet anticorps Lapin Polyclonal détecte spécifiquement GABRB2 dans WB. Il présente une réactivité envers Humain, Rat, Souris, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour GABRB2 anticorps (ABIN633763)

Antigène: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Reactivité: Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GABRB2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GABRB2 anticorps

Purification: Affinity purified

Immunogène: GABRB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GABRB2 Blocking Peptide, (ABIN939192), is also available for use as a blocking control in assays to test for specificity of this GABRB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GABRB2

Antigène: GABRB2 (gamma-aminobutyric Acid (GABA) A Receptor, beta 2 (GABRB2))

Autre désignation: GABRB2

Sujet: The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes GABA A receptor, beta 2 subunit. It is mapped to chromosome 5q34 in a cluster comprised of genes encoding alpha 1 and gamma 2 subunits of the GABA A receptor. The gamma-aminobutyric acid (GABA) A receptor is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Synaptic Membrane