KCNK6 anticorps (N-Term)

N° du produit ABIN633776

L’anticorps Lapin Polyclonal anti-KCNK6 a été validé pour WB. Il convient pour détecter KCNK6 dans des échantillons de Humain.

Aperçu rapide pour KCNK6 anticorps (N-Term) (ABIN633776)

Antigène: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCNK6 anticorps

Épitope: N-Term

Specificité: KCNK6 antibody was raised against the n terminal of KCNK6

Purification: Affinity purified

Immunogène: KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK6 Blocking Peptide, (ABIN5614289), is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK6

Antigène: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Autre désignation: KCNK6

Sujet: KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Poids moléculaire: 34 kDa (MW of target protein)