KCNK6 anticorps (N-Term)

N° du produit ABIN633776

Détail du produit anti-KCNK6 anticorps

Antigène: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK6 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK6 antibody was raised against the n terminal of KCNK6

Purification: Affinity purified

Immunogène: KCNK6 antibody was raised using the N terminal of KCNK6 corresponding to a region with amino acids RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK6 Blocking Peptide, catalog no. 33R-8027, is also available for use as a blocking control in assays to test for specificity of this KCNK6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK6

Antigène: KCNK6 (Potassium Channel Subfamily K Member 6 (KCNK6))

Autre désignation: KCNK6 (KCNK6 Produits)

Synonymes: anticorps Twik2, anticorps Twik-2, anticorps im:7152114, anticorps zgc:110418, anticorps K2p6.1, anticorps KCNK8, anticorps TOSS, anticorps TWIK-2, anticorps TWIK2, anticorps D7Ertd764e, anticorps Toss, anticorps potassium channel, two pore domain subfamily K, member 6, anticorps potassium two pore domain channel subfamily K member 6, anticorps potassium channel, subfamily K, member 6, anticorps potassium inwardly-rectifying channel, subfamily K, member 6, anticorps Kcnk6, anticorps KCNK6, anticorps kcnk6

Sujet: KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

Poids moléculaire: 34 kDa (MW of target protein)