KCNK1 anticorps (Middle Region)

N° du produit ABIN633793

Cet anticorps Lapin Polyclonal détecte spécifiquement KCNK1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour KCNK1 anticorps (Middle Region) (ABIN633793)

Antigène: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCNK1 anticorps

Épitope: Middle Region

Specificité: KCNK1 antibody was raised against the middle region of KCNK1

Purification: Affinity purified

Immunogène: KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK1 Blocking Peptide, (ABIN937712), is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK1

Antigène: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Autre désignation: KCNK1

Sujet: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Poids moléculaire: 38 kDa (MW of target protein)