KCNK1 anticorps (Middle Region)

N° du produit ABIN633793

Détail du produit anti-KCNK1 anticorps

Antigène: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK1 antibody was raised against the middle region of KCNK1

Purification: Affinity purified

Immunogène: KCNK1 antibody was raised using the middle region of KCNK1 corresponding to a region with amino acids EDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPANH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK1 Blocking Peptide, catalog no. 33R-2326, is also available for use as a blocking control in assays to test for specificity of this KCNK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK1

Antigène: KCNK1 (Potassium Channel Subfamily K Member 1 (KCNK1))

Autre désignation: KCNK1 (KCNK1 Produits)

Synonymes: anticorps AI788889, anticorps TWIK-1, anticorps DPK, anticorps HOHO, anticorps K2P1, anticorps K2p1.1, anticorps KCNO1, anticorps TWIK1, anticorps Twik, anticorps k2p1.1, anticorps twik-1, anticorps twik1, anticorps rabKCNK1, anticorps im:7150627, anticorps kcnk1, anticorps zgc:165664, anticorps potassium channel, subfamily K, member 1, anticorps potassium two pore domain channel subfamily K member 1, anticorps potassium channel, two pore domain subfamily K, member 1 L homeolog, anticorps potassium channel, subfamily K, member 1a, anticorps Kcnk1, anticorps KCNK1, anticorps kcnk1.L, anticorps kcnk1a

Sujet: KCNK1 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK1 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

Poids moléculaire: 38 kDa (MW of target protein)