KCNK5 anticorps (C-Term)

N° du produit ABIN633797

L’anticorps Lapin Polyclonal anti-KCNK5 a été validé pour WB. Il convient pour détecter KCNK5 dans des échantillons de Humain.

Aperçu rapide pour KCNK5 anticorps (C-Term) (ABIN633797)

Antigène: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-KCNK5 anticorps

Épitope: C-Term

Specificité: KCNK5 antibody was raised against the C terminal of KCNK5

Purification: Affinity purified

Immunogène: KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK5 Blocking Peptide, (ABIN5614288), is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK5

Antigène: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Autre désignation: KCNK5

Sujet: KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Poids moléculaire: 55 kDa (MW of target protein)