KCNK5 anticorps (Potassium Channel, Subfamily K, Member 5) (C-Term)

Details for Product anti-KCNK5 Antibody No. ABIN633797, Fournisseur: Connectez-vous pour afficher
  • kcnk5
  • zgc:63921
  • task2
  • k2p5.1
  • task-2
  • K2p5.1
  • TASK-2
  • TASK2
  • potassium channel, subfamily K, member 5b
  • potassium two pore domain channel subfamily K member 5
  • potassium channel, two pore domain subfamily K, member 5 S homeolog
  • potassium channel, subfamily K, member 5
  • kcnk5b
  • KCNK5
  • kcnk5.S
  • Kcnk5
Western Blotting (WB)
Connectez-vous pour afficher
N° du produit (Fournisseur)
Connectez-vous pour afficher
Immunogène KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES
Specificité KCNK5 antibody was raised against the C terminal of KCNK5
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others KCNK5 products on genomics-online (e.g. as negative or positive controls)
Autre désignation KCNK5 (KCNK5 Antibody Extrait)
Sujet KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.
Poids moléculaire 55 kDa (MW of target protein)
Indications d'application WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

KCNK5 Blocking Peptide, catalog no. 33R-9078, is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS
Concentration Lot specific
Buffer PBS
Conseil sur la manipulation Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Stock 4 °C
Stockage commentaire Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Images (Fournisseur)
Western Blotting (WB) image for anti-Potassium Channel, Subfamily K, Member 5 (KCNK5) (C-Term) antibody (ABIN633797) KCNK5 antibody used at 0.5 ug/ml to detect target protein.
Avez-vous cherché autre chose?