KCNK5 anticorps (C-Term)

N° du produit ABIN633797

Détail du produit anti-KCNK5 anticorps

Antigène: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNK5 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNK5 antibody was raised against the C terminal of KCNK5

Purification: Affinity purified

Immunogène: KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNK5 Blocking Peptide, catalog no. 33R-9078, is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNK5

Antigène: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Autre désignation: KCNK5 (KCNK5 Produits)

Synonymes: anticorps K2p5.1, anticorps TASK-2, anticorps TASK2, anticorps kcnk5, anticorps zgc:63921, anticorps task2, anticorps k2p5.1, anticorps task-2, anticorps zgc:123271, anticorps potassium two pore domain channel subfamily K member 5, anticorps potassium channel, subfamily K, member 5, anticorps potassium channel, subfamily K, member 5b, anticorps potassium channel, two pore domain subfamily K, member 5 S homeolog, anticorps potassium channel, subfamily K, member 5a, anticorps KCNK5, anticorps Kcnk5, anticorps kcnk5b, anticorps kcnk5.S, anticorps kcnk5a

Sujet: KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Poids moléculaire: 55 kDa (MW of target protein)