HEY1 anticorps (N-Term)

N° du produit ABIN633815

L’anticorps Lapin Polyclonal anti-HEY1 a été validé pour WB. Il convient pour détecter HEY1 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour HEY1 anticorps (N-Term) (ABIN633815)

Antigène: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HEY1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HEY1 anticorps

Épitope: N-Term

Specificité: HEY1 antibody was raised against the N terminal of HEY1

Purification: Affinity purified

Immunogène: HEY1 antibody was raised using the N terminal of HEY1 corresponding to a region with amino acids ALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HEY1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HEY1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HEY1

Antigène: HEY1 (Ha-Ry/enhancer-of-Split Related with YRPW Motif 1 (HEY1))

Autre désignation: HEY1

Sujet: Hairy/enhancer of split-related proteins, such as HEY1, are basic helix-loop-helix (bHLH) transcription factors implicated in cell fate decision and boundary formation.

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Tube Formation