MPPED2 anticorps (N-Term)

N° du produit ABIN633824

L’anticorps anti-MPPED2 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de MPPED2 dans des échantillons provenant de Humain et Rat. }

Aperçu rapide pour MPPED2 anticorps (N-Term) (ABIN633824)

Antigène: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPPED2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MPPED2 anticorps

Épitope: N-Term

Specificité: MPPED2 antibody was raised against the N terminal of MPPED2

Purification: Affinity purified

Immunogène: MPPED2 antibody was raised using the N terminal of MPPED2 corresponding to a region with amino acids RFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPPED2 Blocking Peptide, (ABIN5614832), is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPPED2

Antigène: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Autre désignation: MPPED2

Sujet: The specific function of MPPED2 is not yet known.

Poids moléculaire: 33 kDa (MW of target protein)