PHYH anticorps (Middle Region)

N° du produit ABIN633832

Cet anticorps Lapin Polyclonal détecte spécifiquement PHYH dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour PHYH anticorps (Middle Region) (ABIN633832)

Antigène: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PHYH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PHYH anticorps

Épitope: Middle Region

Specificité: PHYH antibody was raised against the middle region of PHYH

Purification: Affinity purified

Immunogène: PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PHYH Blocking Peptide, (ABIN937889), is also available for use as a blocking control in assays to test for specificity of this PHYH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHYH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PHYH

Antigène: PHYH (Phytanoyl-CoA 2-Hydroxylase (PHYH))

Autre désignation: PHYH

Sujet: This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process