Glutathione Reductase anticorps (N-Term)

N° du produit ABIN633841

Cet anticorps Lapin Polyclonal détecte spécifiquement Glutathione Reductase dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour Glutathione Reductase anticorps (N-Term) (ABIN633841)

Antigène: Glutathione Reductase (GSR)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glutathione Reductase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glutathione Reductase anticorps

Épitope: N-Term

Specificité: GSR antibody was raised against the N terminal of GSR

Purification: Affinity purified

Immunogène: GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSR Blocking Peptide, (ABIN5613886), is also available for use as a blocking control in assays to test for specificity of this GSR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glutathione Reductase

Antigène: Glutathione Reductase (GSR)

Autre désignation: GSR

Sujet: GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Cell RedoxHomeostasis