ECHDC2 anticorps (Middle Region)

N° du produit ABIN633843

Cet anticorps anti-ECHDC2 Polyclonal Lapin (ABIN633843) détecte spécifiquement ECHDC2 dans WB. L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ECHDC2 anticorps (Middle Region) (ABIN633843)

Antigène: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECHDC2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ECHDC2 anticorps

Épitope: Middle Region

Specificité: ECHDC2 antibody was raised against the middle region of ECHDC2

Purification: Affinity purified

Immunogène: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECHDC2 Blocking Peptide, (ABIN938504), is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECHDC2

Antigène: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Autre désignation: ECHDC2

Sujet: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Poids moléculaire: 28 kDa (MW of target protein)