OPTC anticorps (C-Term)

N° du produit ABIN633856

Cet anticorps Lapin Polyclonal détecte spécifiquement OPTC dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour OPTC anticorps (C-Term) (ABIN633856)

Antigène: OPTC (Opticin (OPTC))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OPTC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OPTC anticorps

Épitope: C-Term

Specificité: Opticin antibody was raised against the C terminal of OPTC

Purification: Affinity purified

Immunogène: Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Opticin Blocking Peptide, (ABIN5615128), is also available for use as a blocking control in assays to test for specificity of this Opticin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OPTC

Antigène: OPTC (Opticin (OPTC))

Autre désignation: Opticin

Sujet: Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization.

Poids moléculaire: 35 kDa (MW of target protein)