NOMO1 anticorps (N-Term)

N° du produit ABIN633863

L’anticorps Lapin Polyclonal anti-NOMO1 a été validé pour WB. Il convient pour détecter NOMO1 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour NOMO1 anticorps (N-Term) (ABIN633863)

Antigène: NOMO1 (NODAL Modulator 1 (NOMO1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOMO1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOMO1 anticorps

Épitope: N-Term

Specificité: NOMO1 antibody was raised against the N terminal of NOMO1

Purification: Affinity purified

Immunogène: NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOMO1 Blocking Peptide, (ABIN937351), is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOMO1

Antigène: NOMO1 (NODAL Modulator 1 (NOMO1))

Autre désignation: NOMO1

Sujet: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Poids moléculaire: 134 kDa (MW of target protein)