MMP3 anticorps

N° du produit ABIN633867

Cet anticorps anti-MMP3 est un anticorps Lapin Polyclonal détectant MMP3 dans WB. Adapté pour Humain, Souris et Chien.

Aperçu rapide pour MMP3 anticorps (ABIN633867)

Antigène: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MMP3 anticorps

Purification: Affinity purified

Immunogène: MMP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP3 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this MMP3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP3

Antigène: MMP3 (Matrix Metallopeptidase 3 (Stromelysin 1, Progelatinase) (MMP3))

Autre désignation: MMP3

Sujet: MMP3 can degrade fibronectin, laminin, gelatins of type I, III, IV, and V, collagens III, IV, X, and IX, and cartilage proteoglycans. MMP3 activates procollagenase.Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.

Poids moléculaire: 43 kDa (MW of target protein)