LAIR2 anticorps (N-Term)

N° du produit ABIN633870

Détail du produit anti-LAIR2 anticorps

Antigène: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LAIR2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LAIR2 antibody was raised against the N terminal of LAIR2

Purification: Affinity purified

Immunogène: LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LAIR2 Blocking Peptide, catalog no. 33R-8677, is also available for use as a blocking control in assays to test for specificity of this LAIR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAIR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LAIR2

Antigène: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Autre désignation: LAIR2 (LAIR2 Produits)

Synonymes: anticorps CD306, anticorps leukocyte associated immunoglobulin like receptor 2, anticorps LAIR2

Sujet: LAIR2 is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 16 kDa (MW of target protein)