Afamin anticorps (Middle Region)

N° du produit ABIN633872

Détail du produit anti-Afamin anticorps

Antigène: Afamin (AFM)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Afamin est non-conjugé

Application: Western Blotting (WB)

Specificité: Afamin antibody was raised against the middle region of AFM

Purification: Affinity purified

Immunogène: Afamin antibody was raised using the middle region of AFM corresponding to a region with amino acids GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Afamin Blocking Peptide, catalog no. 33R-3492, is also available for use as a blocking control in assays to test for specificity of this Afamin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AFM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Afamin

Antigène: Afamin (AFM)

Autre désignation: Afamin (AFM Produits)

Synonymes: anticorps AFM, anticorps ALB2, anticorps ALBA, anticorps ALF, anticorps Alf, anticorps alpha-Alb, anticorps afamin, anticorps AFM, anticorps Afm

Sujet: AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutionarily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.

Poids moléculaire: 69 kDa (MW of target protein)