CBLN4 anticorps (C-Term)
-
- Antigène Voir toutes CBLN4 Anticorps
- CBLN4 (Cerebellin 4 Precursor (CBLN4))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CBLN4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CBLN4 antibody was raised against the C terminal of CBLN4
- Purification
- Affinity purified
- Immunogène
- CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
- Top Product
- Discover our top product CBLN4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CBLN4 Blocking Peptide, catalog no. 33R-3868, is also available for use as a blocking control in assays to test for specificity of this CBLN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBLN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CBLN4 (Cerebellin 4 Precursor (CBLN4))
- Autre désignation
- CBLN4 (CBLN4 Produits)
- Synonymes
- anticorps zgc:172190, anticorps cerebellin-4, anticorps CBLNL1, anticorps AI848962, anticorps cerebellin 4 precursor, anticorps cerebellin 4 precursor L homeolog, anticorps cerebellin 4 precursor protein, anticorps CBLN4, anticorps cbln4, anticorps cbln4.L, anticorps Cbln4
- Sujet
- Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.
- Poids moléculaire
- 22 kDa (MW of target protein)
-