ATPase Inhibitory Factor 1 anticorps (N-Term)

N° du produit ABIN633876

Cet anticorps anti-ATPase Inhibitory Factor 1 est un anticorps Lapin Polyclonal détectant ATPase Inhibitory Factor 1 dans WB. Adapté pour Humain.

Aperçu rapide pour ATPase Inhibitory Factor 1 anticorps (N-Term) (ABIN633876)

Antigène: ATPase Inhibitory Factor 1 (ATPIF1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATPase Inhibitory Factor 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATPase Inhibitory Factor 1 anticorps

Épitope: N-Term

Specificité: ATPIF1 antibody was raised against the N terminal of ATPIF1

Purification: Affinity purified

Immunogène: ATPIF1 antibody was raised using the N terminal of ATPIF1 corresponding to a region with amino acids GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATPIF1 Blocking Peptide, (ABIN938953), is also available for use as a blocking control in assays to test for specificity of this ATPIF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPIF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATPase Inhibitory Factor 1

Antigène: ATPase Inhibitory Factor 1 (ATPIF1)

Autre désignation: ATPIF1

Sujet: This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Poids moléculaire: 10 kDa (MW of target protein)