CRISP1 anticorps (N-Term)

N° du produit ABIN633879

Détail du produit anti-CRISP1 anticorps

Antigène: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRISP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: CRISP1 antibody was raised against the N terminal of CRISP1

Purification: Affinity purified

Immunogène: CRISP1 antibody was raised using the N terminal of CRISP1 corresponding to a region with amino acids LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRISP1 Blocking Peptide, catalog no. 33R-5093, is also available for use as a blocking control in assays to test for specificity of this CRISP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRISP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRISP1

Antigène: CRISP1 (Cysteine-Rich Secretory Protein 1 (CRISP1))

Autre désignation: CRISP1 (CRISP1 Produits)

Synonymes: anticorps AEGL1, anticorps ARP, anticorps CRISP-1, anticorps HSCRISP1D, anticorps HSCRISP1G, anticorps HUMARP, anticorps AW324342, anticorps Aeg1, anticorps AEG, anticorps crisp-1, anticorps cysteine rich secretory protein 1, anticorps cysteine-rich secretory protein 1, anticorps CRISP1, anticorps Crisp1

Sujet: Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.

Poids moléculaire: 27 kDa (MW of target protein)