Fibromodulin anticorps (N-Term)
-
- Antigène Voir toutes Fibromodulin (FMOD) Anticorps
- Fibromodulin (FMOD)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fibromodulin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Fibromodulin antibody was raised against the N terminal of FMOD
- Purification
- Affinity purified
- Immunogène
- Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER
- Top Product
- Discover our top product FMOD Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Fibromodulin Blocking Peptide, catalog no. 33R-9917, is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMOD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Fibromodulin (FMOD)
- Autre désignation
- Fibromodulin (FMOD Produits)
- Synonymes
- anticorps FMOD, anticorps AI131919, anticorps AU041740, anticorps SLRR2E, anticorps LOC100286414, anticorps sc:d0415, anticorps si:dkey-31j12.4, anticorps LOC100229381, anticorps FM, anticorps fibromodulin, anticorps fibromodulin b, anticorps FMOD, anticorps Fmod, anticorps LOC100286414, anticorps fmodb
- Sujet
- Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Glycosaminoglycan Metabolic Process
-