FBLN4 anticorps (Middle Region)

N° du produit ABIN633884

Détail du produit anti-FBLN4 anticorps

Antigène: FBLN4 (Fibulin 4 (FBLN4))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBLN4 est non-conjugé

Application: Western Blotting (WB)

Specificité: EFEMP2 antibody was raised against the middle region of EFEMP2

Purification: Affinity purified

Immunogène: EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFEMP2 Blocking Peptide, catalog no. 33R-9797, is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBLN4

Antigène: FBLN4 (Fibulin 4 (FBLN4))

Autre désignation: EFEMP2 (FBLN4 Produits)

Synonymes: anticorps CB257, anticorps fbln4, anticorps fc56c09, anticorps id:ibd2923, anticorps sb:cb257, anticorps wu:fc56c09.x1, anticorps ARCL1B, anticorps FBLN4, anticorps MBP1, anticorps UPH1, anticorps 0610011K11Rik, anticorps Fbln4, anticorps FIBL-4, anticorps Fibulin-4, anticorps H411, anticorps EGF-containing fibulin-like extracellular matrix protein 2, anticorps EGF containing fibulin-like extracellular matrix protein 2b, anticorps fibulin 4, anticorps EGF containing fibulin like extracellular matrix protein 2, anticorps epidermal growth factor-containing fibulin-like extracellular matrix protein 2, anticorps Efemp2, anticorps efemp2b, anticorps fbln4, anticorps EFEMP2

Sujet: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

Poids moléculaire: 49 kDa (MW of target protein)