FBLN4 anticorps (Middle Region)

N° du produit ABIN633884

L’anticorps anti-FBLN4 Polyclonal Lapin est utilisé pour la détection de FBLN4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FBLN4 anticorps (Middle Region) (ABIN633884)

Antigène: FBLN4 (Fibulin 4 (FBLN4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBLN4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBLN4 anticorps

Épitope: Middle Region

Specificité: EFEMP2 antibody was raised against the middle region of EFEMP2

Purification: Affinity purified

Immunogène: EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFEMP2 Blocking Peptide, (ABIN5613312), is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBLN4

Antigène: FBLN4 (Fibulin 4 (FBLN4))

Autre désignation: EFEMP2

Sujet: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

Poids moléculaire: 49 kDa (MW of target protein)