LOXL1 anticorps (N-Term)
-
- Antigène Voir toutes LOXL1 Anticorps
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LOXL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LOXL1 antibody was raised against the N terminal of LOXL1
- Purification
- Affinity purified
- Immunogène
- LOXL1 antibody was raised using the N terminal of LOXL1 corresponding to a region with amino acids RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR
- Top Product
- Discover our top product LOXL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LOXL1 Blocking Peptide, catalog no. 33R-8268, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))
- Autre désignation
- LOXL1 (LOXL1 Produits)
- Synonymes
- anticorps LOL, anticorps LOXL, anticorps Loxl, anticorps si:ch211-238c15.1, anticorps lol, anticorps loxl, anticorps loxl-1, anticorps oxl-1, anticorps lysyl oxidase like 1, anticorps lysyl oxidase-like 1, anticorps lysyl oxidase like 1 L homeolog, anticorps LOXL1, anticorps loxl1, anticorps Loxl1, anticorps loxl1.L
- Sujet
- LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
- Poids moléculaire
- 53 kDa (MW of target protein)
-