IGFBP7 anticorps (C-Term)

N° du produit ABIN633886

Détail du produit anti-IGFBP7 anticorps

Antigène: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Épitope: C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IGFBP7 est non-conjugé

Application: Western Blotting (WB)

Specificité: IGFBP7 antibody was raised against the C terminal of IGFBP7

Purification: Affinity purified

Immunogène: IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IGFBP7 Blocking Peptide, catalog no. 33R-7926, is also available for use as a blocking control in assays to test for specificity of this IGFBP7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IGFBP7

Antigène: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Autre désignation: IGFBP7 (IGFBP7 Produits)

Synonymes: anticorps zgc:85888, anticorps AGM, anticorps FSTL2, anticorps IBP-7, anticorps IGFBP-7, anticorps IGFBP-7v, anticorps IGFBPRP1, anticorps MAC25, anticorps PSF, anticorps RAMSVPS, anticorps TAF, anticorps Fstl2, anticorps Mac25, anticorps insulin like growth factor binding protein 7, anticorps insulin-like growth factor binding protein 7, anticorps IGFBP7, anticorps igfbp7, anticorps Igfbp7

Sujet: IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Growth Factor Binding