MRPL47 anticorps (Middle Region)

N° du produit ABIN633887

L’anticorps Lapin Polyclonal anti-MRPL47 a été validé pour WB. Il convient pour détecter MRPL47 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour MRPL47 anticorps (Middle Region) (ABIN633887)

Antigène: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MRPL47 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MRPL47 anticorps

Épitope: Middle Region

Specificité: MRPL47 antibody was raised against the middle region of MRPL47

Purification: Affinity purified

Immunogène: MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MRPL47 Blocking Peptide, (ABIN5614845), is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MRPL47

Antigène: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Autre désignation: MRPL47

Sujet: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Poids moléculaire: 17 kDa (MW of target protein)