OXCT1 anticorps (Middle Region)

N° du produit ABIN633896

L’anticorps anti-OXCT1 Polyclonal Lapin est utilisé pour la détection de OXCT1 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour OXCT1 anticorps (Middle Region) (ABIN633896)

Antigène: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OXCT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OXCT1 anticorps

Épitope: Middle Region

Specificité: OXCT1 antibody was raised against the middle region of OXCT1

Purification: Affinity purified

Immunogène: OXCT1 antibody was raised using the middle region of OXCT1 corresponding to a region with amino acids GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OXCT1 Blocking Peptide, (ABIN938828), is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OXCT1

Antigène: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Autre désignation: OXCT1

Sujet: CT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis