PCCB anticorps (Middle Region)

N° du produit ABIN633897

Détail du produit anti-PCCB anticorps

Antigène: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCCB est non-conjugé

Application: Western Blotting (WB)

Specificité: PCCB antibody was raised against the middle region of PCCB

Purification: Affinity purified

Immunogène: PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCCB Blocking Peptide, catalog no. 33R-7102, is also available for use as a blocking control in assays to test for specificity of this PCCB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCCB

Antigène: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Autre désignation: PCCB (PCCB Produits)

Synonymes: anticorps 1300012P06Rik, anticorps AI314687, anticorps R74805, anticorps propionyl-CoA carboxylase beta subunit, anticorps propionyl Coenzyme A carboxylase, beta polypeptide, anticorps PCCB, anticorps Pccb

Sujet: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process