PYCR1 anticorps (Middle Region)

N° du produit ABIN633902

L’anticorps anti-PYCR1 Polyclonal Lapin est utilisé pour la détection de PYCR1 dans des échantillons de Humain et Rat. Il a été validé pour WB.

Aperçu rapide pour PYCR1 anticorps (Middle Region) (ABIN633902)

Antigène: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PYCR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PYCR1 anticorps

Épitope: Middle Region

Specificité: PYCR1 antibody was raised against the middle region of PYCR1

Purification: Affinity purified

Immunogène: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PYCR1 Blocking Peptide, (ABIN939945), is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PYCR1

Antigène: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Autre désignation: PYCR1

Sujet: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Poids moléculaire: 33 kDa (MW of target protein)