PYCR1 anticorps (Middle Region)
-
- Antigène Voir toutes PYCR1 Anticorps
- PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PYCR1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PYCR1 antibody was raised against the middle region of PYCR1
- Purification
- Affinity purified
- Immunogène
- PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR
- Top Product
- Discover our top product PYCR1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PYCR1 Blocking Peptide, catalog no. 33R-4559, is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))
- Autre désignation
- PYCR1 (PYCR1 Produits)
- Synonymes
- anticorps arcl2b, anticorps p5c, anticorps p5cr, anticorps pig45, anticorps pp222, anticorps pro3, anticorps pycr, anticorps ARCL2B, anticorps ARCL3B, anticorps P5C, anticorps P5CR, anticorps PIG45, anticorps PP222, anticorps PRO3, anticorps PYCR, anticorps zgc:73112, anticorps pyrroline-5-carboxylate reductase family, member 1 L homeolog, anticorps pyrroline-5-carboxylate reductase 1, anticorps pyrroline-5-carboxylate reductase 1a, anticorps pycr1.L, anticorps PYCR1, anticorps Pycr1, anticorps pycr1a
- Sujet
- This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.
- Poids moléculaire
- 33 kDa (MW of target protein)
-