Tachykinin 3 anticorps

N° du produit ABIN633913

Cet anticorps Lapin Polyclonal détecte spécifiquement Tachykinin 3 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Tachykinin 3 anticorps (ABIN633913)

Antigène: Tachykinin 3 (TAC3)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tachykinin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Tachykinin 3 anticorps

Purification: Affinity purified

Immunogène: Tachykinin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tachykinin 3 Blocking Peptide, (ABIN5616493), is also available for use as a blocking control in assays to test for specificity of this Tachykinin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TAC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tachykinin 3

Antigène: Tachykinin 3 (TAC3)

Autre désignation: Tachykinin 3

Sujet: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.

Poids moléculaire: 13 kDa (MW of target protein)