Sep 15 anticorps (Middle Region)

N° du produit ABIN633919

Cet anticorps Lapin Polyclonal détecte spécifiquement Sep 15 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Sep 15 anticorps (Middle Region) (ABIN633919)

Antigène: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sep 15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Sep 15 anticorps

Épitope: Middle Region

Specificité: Selenoprotein antibody was raised against the middle region of 15 kDa Selenoprotein

Purification: Affinity purified

Immunogène: Selenoprotein antibody was raised using the middle region of 15 kDa Selenoprotein corresponding to a region with amino acids SDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Selenoprotein Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Selenoprotein antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 42248 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sep 15

Antigène: Sep 15 (SEP15) (15 KDa Selenoprotein (SEP15))

Autre désignation: Selenoprotein

Sujet: SEP15 is a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. Studies in mouse suggest that this selenoprotein may have redox function and may be involved in the quality control of protein folding. The gene that encodes the protein is localized on chromosome 1p31, a genetic locus commonly mutated or deleted in human cancers.

Poids moléculaire: 15 kDa (MW of target protein)