FBLN3 anticorps (Middle Region)

N° du produit ABIN633923

Détail du produit anti-FBLN3 anticorps

Antigène: FBLN3 (Fibulin 3 (FBLN3))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBLN3 est non-conjugé

Application: Western Blotting (WB)

Specificité: EFEMP1 antibody was raised against the middle region of EFEMP1

Purification: Affinity purified

Immunogène: EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EFEMP1 Blocking Peptide, catalog no. 33R-4746, is also available for use as a blocking control in assays to test for specificity of this EFEMP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBLN3

Antigène: FBLN3 (Fibulin 3 (FBLN3))

Autre désignation: EFEMP1 (FBLN3 Produits)

Synonymes: anticorps DHRD, anticorps DRAD, anticorps FBLN3, anticorps FBNL, anticorps FIBL-3, anticorps MLVT, anticorps MTLV, anticorps S1-5, anticorps T16, anticorps EGF containing fibulin like extracellular matrix protein 1, anticorps EGF-containing fibulin-like extracellular matrix protein 1, anticorps epidermal growth factor-containing fibulin-like extracellular matrix protein 1, anticorps EFEMP1, anticorps Efemp1

Sujet: EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway