EPHX1 anticorps

N° du produit ABIN633927

Cet anticorps anti-EPHX1 Polyclonal Lapin (ABIN633927) détecte spécifiquement EPHX1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour EPHX1 anticorps (ABIN633927)

Antigène: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPHX1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EPHX1 anticorps

Purification: Affinity purified

Immunogène: EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPHX1 Blocking Peptide, (ABIN938858), is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPHX1

Antigène: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Autre désignation: EPHX1

Sujet: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Poids moléculaire: 53 kDa (MW of target protein)