EPHX1 anticorps

N° du produit ABIN633927

Détail du produit anti-EPHX1 anticorps

Antigène: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EPHX1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EPHX1 Blocking Peptide, catalog no. 33R-3472, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EPHX1

Antigène: EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))

Autre désignation: EPHX1 (EPHX1 Produits)

Synonymes: anticorps NV13267, anticorps DRB1, anticorps DSRNA-BINDING PROTEIN 1, anticorps F21M12.9, anticorps F21M12_9, anticorps HYPONASTIC LEAVES 1, anticorps AI195553, anticorps Eph-1, anticorps Eph1, anticorps mEH, anticorps EPHX, anticorps EPOX, anticorps HYL1, anticorps MEH, anticorps zgc:56126, anticorps ephx, anticorps epox, anticorps meh, anticorps MEH8, anticorps epoxide hydrolase 1, anticorps epoxide hydrolase 1, microsomal (xenobiotic), anticorps Epoxide hydrolase 1, anticorps dsRNA-binding domain-like superfamily protein, anticorps epoxide hydrolase 1, microsomal, anticorps epoxide hydrolase 1, microsomal (xenobiotic) L homeolog, anticorps EPHX1, anticorps Eh1, anticorps hyep, anticorps HYL1, anticorps Ephx1, anticorps ephx1, anticorps ephx1.L

Sujet: Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.

Poids moléculaire: 53 kDa (MW of target protein)