SMPDL3B anticorps (N-Term)

N° du produit ABIN633930

Détail du produit anti-SMPDL3B anticorps

Antigène: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMPDL3B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SMPDL3 B antibody was raised against the N terminal of SMPDL3

Purification: Affinity purified

Immunogène: SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMPDL3B

Antigène: SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))

Autre désignation: SMPDL3B (SMPDL3B Produits)

Synonymes: anticorps ASML3B, anticorps 1110054A24Rik, anticorps AU045240, anticorps Asml3b, anticorps im:7137990, anticorps si:ch1073-55d10.1, anticorps sphingomyelin phosphodiesterase acid like 3B, anticorps sphingomyelin phosphodiesterase, acid-like 3B, anticorps SMPDL3B, anticorps Smpdl3b, anticorps smpdl3b

Sujet: Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.

Poids moléculaire: 52 kDa (MW of target protein)