PON1 anticorps (C-Term)

N° du produit ABIN633935

Détail du produit anti-PON1 anticorps

Antigène: PON1 (Paraoxonase 1 (PON1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PON1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PON1 antibody was raised against the C terminal of PON1

Purification: Affinity purified

Immunogène: PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PON1 Blocking Peptide, catalog no. 33R-1504, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PON1

Antigène: PON1 (Paraoxonase 1 (PON1))

Autre désignation: PON1 (PON1 Produits)

Synonymes: anticorps esa, anticorps pon, anticorps pon2, anticorps MGC53915, anticorps MGC89222, anticorps PON1, anticorps ESA, anticorps MVCD5, anticorps PON, anticorps Pon, anticorps paraoxonase 2, anticorps paraoxonase 1, anticorps pon2, anticorps PON1, anticorps Pon1

Sujet: PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.

Poids moléculaire: 39 kDa (MW of target protein)