FGL1 anticorps (Middle Region)

N° du produit ABIN633938

L’anticorps anti-FGL1 Polyclonal Lapin est utilisé pour la détection de FGL1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FGL1 anticorps (Middle Region) (ABIN633938)

Antigène: FGL1 (Fibrinogen-Like 1 (FGL1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGL1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FGL1 anticorps

Épitope: Middle Region

Specificité: FGL1 antibody was raised against the middle region of FGL1

Purification: Affinity purified

Immunogène: FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGL1 Blocking Peptide, (ABIN937799), is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGL1

Antigène: FGL1 (Fibrinogen-Like 1 (FGL1))

Autre désignation: FGL1

Sujet: Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.

Poids moléculaire: 34 kDa (MW of target protein)