FGL1 anticorps (Middle Region)
-
- Antigène Voir toutes FGL1 Anticorps
- FGL1 (Fibrinogen-Like 1 (FGL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FGL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FGL1 antibody was raised against the middle region of FGL1
- Purification
- Affinity purified
- Immunogène
- FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL
- Top Product
- Discover our top product FGL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FGL1 Blocking Peptide, catalog no. 33R-2413, is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FGL1 (Fibrinogen-Like 1 (FGL1))
- Autre désignation
- FGL1 (FGL1 Produits)
- Synonymes
- anticorps MGC84748, anticorps FGL1, anticorps DKFZp470A2333, anticorps Frep1, anticorps Lfire1, anticorps HFREP1, anticorps HP-041, anticorps LFIRE-1, anticorps LFIRE1, anticorps Mfire1, anticorps fibrinogen like 1 L homeolog, anticorps fibrinogen like 1, anticorps fibrinogen-like 1, anticorps fibrinogen-like protein 1, anticorps fgl1.L, anticorps FGL1, anticorps Fgl1
- Sujet
- Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.
- Poids moléculaire
- 34 kDa (MW of target protein)
-